hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-15082882/chunk_1/iprscan-20080502-15082882.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0860 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04564.6.fs U-box domain 154.0 3.9e-55 1 PF04564.6.ls U-box domain 156.0 9e-44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04564.6.fs 1/1 268 348 .. 1 81 [] 154.0 3.9e-55 PF04564.6.ls 1/1 268 348 .. 1 81 [] 156.0 9e-44 Alignments of top-scoring domains: PF04564.6.fs: domain 1 of 1, from 268 to 348: score 154.0, E = 3.9e-55 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEA.WGvdp D+P+EFlDPItle+M++P+ lPSG +++D+st+e++++sEA+WG+ p KIAA0860 268 DVPEEFLDPITLEIMPCPMLLPSG-KVIDQSTLEKCNRSEAtWGRVP 313 tDPftGRepLthdeLiPNleLKekIdawleekrea<-* +DPftG+++++h+++ P+++LK++Id++l +++++ KIAA0860 314 SDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIP 348 PF04564.6.ls: domain 1 of 1, from 268 to 348: score 156.0, E = 9e-44 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEA.WGvdp D+P+EFlDPItle+M++P+ lPSG +++D+st+e++++sEA+WG+ p KIAA0860 268 DVPEEFLDPITLEIMPCPMLLPSG-KVIDQSTLEKCNRSEAtWGRVP 313 tDPftGRepLthdeLiPNleLKekIdawleekrea<-* +DPftG+++++h+++ P+++LK++Id++l +++++ KIAA0860 314 SDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIP 348 //