hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-14312020/chunk_1/iprscan-20080502-14312020.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0838 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00248 33.3 3.3e-05 2 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00248 1/2 593 623 .. 1 30 [] 28.3 0.0011 SM00248 2/2 627 656 .. 1 30 [] 5.0 1e+03 Alignments of top-scoring domains: SM00248: domain 1 of 2, from 593 to 623: score 28.3, E = 0.0011 *->dGrTpLHlAaengnlevvklLldkga.dina<-* d rT+LH+Aa++g++evvk+Ll++ ++ KIAA0838 593 DSRTALHVAAAEGHVEVVKFLLEACKvNPFP 623 SM00248: domain 2 of 2, from 627 to 656: score 5.0, E = 1e+03 *->dGrTpLHlAaengnlevvklLldkgadina<-* ++Tp+ A g+++v k+L ++ + + KIAA0838 627 WNNTPMDEALHFGHHDVFKILQEYQVQYTP 656 //