hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-14061346/chunk_1/iprscan-20080502-14061346.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0823 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00023.20.ls Ankyrin repeat 161.4 2.2e-45 5 PF00023.20.fs Ankyrin repeat 153.6 4.9e-43 5 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00023.20.ls 1/5 78 110 .. 1 33 [] 8.4 1.8 PF00023.20.fs 1/5 82 110 .. 5 33 .] 8.6 0.2 PF00023.20.ls 2/5 111 143 .. 1 33 [] 45.4 1.8e-10 PF00023.20.fs 2/5 111 143 .. 1 33 [] 43.4 4e-11 PF00023.20.ls 3/5 144 176 .. 1 33 [] 40.8 4.4e-09 PF00023.20.fs 3/5 144 176 .. 1 33 [] 38.8 7.8e-10 PF00023.20.fs 4/5 239 271 .. 1 33 [] 24.2 9e-06 PF00023.20.ls 4/5 239 271 .. 1 33 [] 26.2 0.00011 PF00023.20.fs 5/5 272 304 .. 1 33 [] 38.5 9.4e-10 PF00023.20.ls 5/5 272 304 .. 1 33 [] 40.5 5.4e-09 Alignments of top-scoring domains: PF00023.20.ls: domain 1 of 5, from 78 to 110: score 8.4, E = 1.8 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* + +L A+lr+++e v+++l++ ++++ + KIAA0823 78 EASVALLEASLRNDAEEVRYFLKNKVSPDLCNE 110 PF00023.20.fs: domain 1 of 5, from 82 to 110: score 8.6, E = 0.2 *->PLHlAalrgnlevvklLlsqGAdlnaqdd<-* +L A+lr+++e v+++l++ ++++ + KIAA0823 82 ALLEASLRNDAEEVRYFLKNKVSPDLCNE 110 PF00023.20.ls: domain 2 of 5, from 111 to 143: score 45.4, E = 1.8e-10 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* dG T+LH ++ + +e+vklLls+GA++na+d+ KIAA0823 111 DGLTALHQCCIDNFEEIVKLLLSHGANVNAKDN 143 PF00023.20.fs: domain 2 of 5, from 111 to 143: score 43.4, E = 4e-11 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* dG T+LH ++ + +e+vklLls+GA++na+d+ KIAA0823 111 DGLTALHQCCIDNFEEIVKLLLSHGANVNAKDN 143 PF00023.20.ls: domain 3 of 5, from 144 to 176: score 40.8, E = 4.4e-09 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* + +TPLH Aa +g++++vk L+++GAdl a++ KIAA0823 144 ELWTPLHAAATCGHINLVKILVQYGADLLAVNS 176 PF00023.20.fs: domain 3 of 5, from 144 to 176: score 38.8, E = 7.8e-10 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* + +TPLH Aa +g++++vk L+++GAdl a++ KIAA0823 144 ELWTPLHAAATCGHINLVKILVQYGADLLAVNS 176 PF00023.20.fs: domain 4 of 5, from 239 to 271: score 24.2, E = 9e-06 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G T LH+A +g+l+ ++lLl++G ++++d KIAA0823 239 QGATLLHIAGANGYLRAAELLLDHGVRVDVKDW 271 PF00023.20.ls: domain 4 of 5, from 239 to 271: score 26.2, E = 0.00011 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* G T LH+A +g+l+ ++lLl++G ++++d KIAA0823 239 QGATLLHIAGANGYLRAAELLLDHGVRVDVKDW 271 PF00023.20.fs: domain 5 of 5, from 272 to 304: score 38.5, E = 9.4e-10 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* dG+ PLH Aa++g++++++lL+s+GA+l a++ KIAA0823 272 DGWEPLHAAAFWGQMQMAELLVSHGASLSARTS 304 PF00023.20.ls: domain 5 of 5, from 272 to 304: score 40.5, E = 5.4e-09 *->dGfTPLHlAalrgnlevvklLlsqGAdlnaqdd<-* dG+ PLH Aa++g++++++lL+s+GA+l a++ KIAA0823 272 DGWEPLHAAAFWGQMQMAELLVSHGASLSARTS 304 //