hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-12234199/chunk_1/iprscan-20080502-12234199.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0764 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00576 111.9 7.1e-29 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00576 1/1 156 235 .. 1 83 [] 111.9 7.1e-29 Alignments of top-scoring domains: SM00576: domain 1 of 1, from 156 to 235: score 111.9, E = 7.1e-29 *->delafsLlkvavsqilesaGFdstqeShaLetLtdilqsYIqelgrt ++ +++Ll++av++il++aGFd+++eS +LetLtd++++Y+++++++ KIAA0764 156 WHSCRQLLYQAVATILAHAGFDCANES-VLETLTDVAHEYCLKFTKL 201 ahryavElaGRtepnDialgDvv.laLenlGidsvge<-* r+av++++R ++ +++Dv++++++++Gi+sv++ KIAA0764 202 -LRFAVDREARLGQT--PFPDVMeQVFHEVGIGSVLS 235 //