hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-10544723/chunk_1/iprscan-20080502-10544723.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0712 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00620.17.fs RhoGAP domain 232.3 3.1e-68 1 PF00620.17.ls RhoGAP domain 234.2 2.6e-67 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00620.17.fs 1/1 69 222 .. 1 155 [] 232.3 3.1e-68 PF00620.17.ls 1/1 69 222 .. 1 155 [] 234.2 2.6e-67 Alignments of top-scoring domains: PF00620.17.fs: domain 1 of 1, from 69 to 222: score 232.3, E = 3.1e-68 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. P+++++C++f+e++G ++GIyR+sG +s i++Lr++fd+++++dl+ KIAA0712 69 PQVLQSCTAFIERYG-IVDGIYRLSGVASNIQRLRHEFDSEHVPDLt 114 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerle +++ +d+h+v sl Kl++ReLP+PLlt++lye+f + a++ ++eerl KIAA0712 115 KEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSD-AVSAATDEERLI 163 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl ++++++++LPp++++tL++L++hL+ a+++++++M a+NLAiv++P+Ll KIAA0712 164 KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLL 213 rppdgdsad<-* r+++ +sa+ KIAA0712 214 RSKQIESAC 222 PF00620.17.ls: domain 1 of 1, from 69 to 222: score 234.2, E = 2.6e-67 *->PlivekCieflekrGLdtEGIyRvsGsksrikeLreafdrgedvdl. P+++++C++f+e++G ++GIyR+sG +s i++Lr++fd+++++dl+ KIAA0712 69 PQVLQSCTAFIERYG-IVDGIYRLSGVASNIQRLRHEFDSEHVPDLt 114 ndleeedvhvvAslLKlFLReLPePLltfelyeefieaaaksedeeerle +++ +d+h+v sl Kl++ReLP+PLlt++lye+f + a++ ++eerl KIAA0712 115 KEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSD-AVSAATDEERLI 163 alrellrkLPpaNrdtLryLlahLnrVaqnsevNkMtahNLAivFgPtLl ++++++++LPp++++tL++L++hL+ a+++++++M a+NLAiv++P+Ll KIAA0712 164 KIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLL 213 rppdgdsad<-* r+++ +sa+ KIAA0712 214 RSKQIESAC 222 //