hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-10072008/chunk_1/iprscan-20080502-10072008.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0684 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF04564.6.fs U-box domain 157.1 3.1e-56 1 PF04564.6.ls U-box domain 159.0 1.2e-44 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF04564.6.fs 1/1 1143 1216 .. 1 81 [] 157.1 3.1e-56 PF04564.6.ls 1/1 1143 1216 .. 1 81 [] 159.0 1.2e-44 Alignments of top-scoring domains: PF04564.6.fs: domain 1 of 1, from 1143 to 1216: score 157.1, E = 3.1e-56 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D+PDEF+DP++++LM+DPV lPSG +++DRs+I+rHLl+ +pt KIAA0684 1143 DAPDEFRDPLMDTLMTDPVRLPSG-TIMDRSIILRHLLN-----SPT 1183 DPftGRepLthdeLiPNleLKekIdawleekrea<-* DPf+ R+ Lt+++L P +eLKe+I+aw++ek+++ KIAA0684 1184 DPFN-RQTLTESMLEPVPELKEQIQAWMREKQNS 1216 PF04564.6.ls: domain 1 of 1, from 1143 to 1216: score 159.0, E = 1.2e-44 *->DiPDEFlDPItleLMkDPVilPSGkityDRstIerHLlsEAWGvdpt D+PDEF+DP++++LM+DPV lPSG +++DRs+I+rHLl+ +pt KIAA0684 1143 DAPDEFRDPLMDTLMTDPVRLPSG-TIMDRSIILRHLLN-----SPT 1183 DPftGRepLthdeLiPNleLKekIdawleekrea<-* DPf+ R+ Lt+++L P +eLKe+I+aw++ek+++ KIAA0684 1184 DPFN-RQTLTESMLEPVPELKEQIQAWMREKQNS 1216 //