hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-09025723/chunk_1/iprscan-20080502-09025723.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA0647
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00064                                                 121.3    1.1e-31   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00064    1/1    1106  1175 ..     1    81 []   121.3  1.1e-31

Alignments of top-scoring domains:
SM00064: domain 1 of 1, from 1106 to 1175: score 121.3, E = 1.1e-31
                   *->etaphWvpDeeasnClmnCgkeFtlvtrRrHHCRnCGrifCskCssk
                       + ++WvpD++as+C +nC++eF+l ++RrHHCRnCG++fC+ C++ 
    KIAA0647  1106    TEVTRWVPDHMASHC-YNCDCEFWL-AKRRHHCRNCGNVFCAGCCHL 1150 

                   kaplpklgkekkngknedftpvRVCdsCyerlsk<-*
                   k+p+p+++ ++         pv VC+sCye+++    
    KIAA0647  1151 KLPIPDQQLYD---------PVLVCNSCYEHIQV    1175 

//