hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-08575917/chunk_1/iprscan-20080502-08575917.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0644 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00369 272.3 3.7e-77 11 SM00082 26.5 0.0037 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00369 1/11 158 181 .. 1 24 [] 33.0 4e-05 SM00369 2/11 182 205 .. 1 24 [] 26.5 0.0037 SM00369 3/11 206 229 .. 1 24 [] 22.5 0.057 SM00369 4/11 230 253 .. 1 24 [] 23.2 0.036 SM00369 5/11 254 277 .. 1 24 [] 24.5 0.015 SM00369 6/11 278 303 .. 1 24 [] 6.7 63 SM00369 7/11 304 327 .. 1 24 [] 26.0 0.0053 SM00369 8/11 328 351 .. 1 24 [] 28.5 0.00095 SM00369 9/11 352 375 .. 1 24 [] 24.4 0.015 SM00369 10/11 376 399 .. 1 24 [] 31.1 0.00016 SM00369 11/11 400 423 .. 1 24 [] 25.9 0.0054 SM00082 1/1 435 491 .. 1 55 [] 26.5 0.0037 Alignments of top-scoring domains: SM00369: domain 1 of 11, from 158 to 181: score 33.0, E = 4e-05 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++Lr+LdL++Nq++sL+p +F+ KIAA0644 158 LGQLRRLDLQYNQIRSLHPKTFEK 181 SM00369: domain 2 of 11, from 182 to 205: score 26.5, E = 0.0037 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+ L+eL+L+nN L++L pg++++ KIAA0644 182 LSRLEELYLGNNLLQALAPGTLAP 205 SM00369: domain 3 of 11, from 206 to 229: score 22.5, E = 0.057 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++Lr L+ ++N +++L +g F+g KIAA0644 206 LRKLRILYANGNEISRLSRGSFEG 229 SM00369: domain 4 of 11, from 230 to 253: score 23.2, E = 0.036 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L +L +L+L++N+L +LP+ +F++ KIAA0644 230 LESLVKLRLDGNALGALPDAVFAP 253 SM00369: domain 5 of 11, from 254 to 277: score 24.5, E = 0.015 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+nL L+L++N+++ L +aF+ KIAA0644 254 LGNLLYLHLESNRIRFLGKNAFAQ 277 SM00369: domain 6 of 11, from 278 to 303: score 6.7, E = 63 *->LpnLreLdLsnNqL.tsLP.pgaFqg<-* L++Lr L+Ls N L+ sL ++ +F++ KIAA0644 278 LGKLRFLNLSANELqPSLRhAATFAP 303 SM00369: domain 7 of 11, from 304 to 327: score 26.0, E = 0.0053 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L +L Ls N L++L p++Fq+ KIAA0644 304 LRSLSSLILSANSLQHLGPRIFQH 327 SM00369: domain 8 of 11, from 328 to 351: score 28.5, E = 0.00095 *->LpnLreLdLsnNqLtsLPpgaFqg<-* Lp L L+L +NqLt+L p+aF+g KIAA0644 328 LPRLGLLSLRGNQLTHLAPEAFWG 351 SM00369: domain 9 of 11, from 352 to 375: score 24.4, E = 0.015 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L +LreL+L++N+L++LP ++++ KIAA0644 352 LEALRELRLEGNRLSQLPTALLEP 375 SM00369: domain 10 of 11, from 376 to 399: score 31.1, E = 0.00016 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L++L+ LdLs+N L++L+p +F++ KIAA0644 376 LHSLEALDLSGNELSALHPATFGH 399 SM00369: domain 11 of 11, from 400 to 423: score 25.9, E = 0.0054 *->LpnLreLdLsnNqLtsLPpgaFqg<-* L+ LreL+L nN+L++L ++F+ KIAA0644 400 LGRLRELSLRNNALSALSGDIFAA 423 SM00082: domain 1 of 1, from 435 to 491: score 26.5, E = 0.0037 *->NPfnCDCeLrwLlrwleaqnnealqdpvsslrCasPeslrGqpllll N + CDC+Lr L+rw + +++ + v ++C +P++lrG + l++ KIAA0644 435 NGWTCDCRLRGLKRWMGDWHSQGRLLTV-FVQCRHPPALRG-KYLDY 479 lp....sefsCp<-* l++++ ++ sC KIAA0644 480 LDdqqlQNGSCA 491 //