hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-06004313/chunk_1/iprscan-20080502-06004313.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0543 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01352.17.fs KRAB box 86.1 7.8e-24 1 PF01352.17.ls KRAB box 88.1 2.4e-23 1 PF05699.5.fs hAT family dimerisation domain 19.6 4.8e-05 1 PF05699.5.ls hAT family dimerisation domain 18.5 0.00034 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01352.17.fs 1/1 275 315 .. 1 41 [] 86.1 7.8e-24 PF01352.17.ls 1/1 275 315 .. 1 41 [] 88.1 2.4e-23 PF05699.5.ls 1/1 931 1014 .. 1 94 [] 18.5 0.00034 PF05699.5.fs 1/1 958 1008 .. 36 88 .. 19.6 4.8e-05 Alignments of top-scoring domains: PF01352.17.fs: domain 1 of 1, from 275 to 315: score 86.1, E = 7.8e-24 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* V FeDVaV+Ft+EEW+ Ld Q++LYrdVM+ Ny+ L+Slg KIAA0543 275 VVFEDVAVYFTREEWGMLDKRQKELYRDVMRMNYELLASLG 315 PF01352.17.ls: domain 1 of 1, from 275 to 315: score 88.1, E = 2.4e-23 *->VtFeDVaVdFtqEEWelLdpaQrnLYrdVMlENysnLvSlg<-* V FeDVaV+Ft+EEW+ Ld Q++LYrdVM+ Ny+ L+Slg KIAA0543 275 VVFEDVAVYFTREEWGMLDKRQKELYRDVMRMNYELLASLG 315 PF05699.5.ls: domain 1 of 1, from 931 to 1014: score 18.5, E = 0.00034 *->ELdkYlselpvlprnteprgledfdvLeWWkeaqnssryPiLsklAr L+++l + + ++ +f L+ + + r+P+Lskl KIAA0543 931 LLEEWLGL-KTIAQHL------PFSMLCKNA-LAQHCRFPLLSKLMA 969 diLsiPvssaasErsFStgklgrvldesrnrlepenveaLlcledwl<-* + ++P+s+ +Er F ++ r+ ++ r++l e +++L+ + + KIAA0543 970 VVVCVPISTSCCERGFKAM--NRIRTDERTKLSNEVLNMLMMTAVNG 1014 PF05699.5.fs: domain 1 of 1, from 958 to 1008: score 19.6, E = 4.8e-05 *->ssryPiLsklArdiLsiPvssaasErsFStgklgrvldesrnrlepe + r+P+Lskl + ++P+s+ +Er F ++ r+ ++ r++l e KIAA0543 958 HCRFPLLSKLMAVVVCVPISTSCCERGFKAM--NRIRTDERTKLSNE 1002 nveaLl<-* +++L+ KIAA0543 1003 VLNMLM 1008 //