hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-05171952/chunk_1/iprscan-20080502-05171952.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0518 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF00010.16.fs Helix-loop-helix DNA-binding domain 49.0 1.8e-12 1 PF00010.16.ls Helix-loop-helix DNA-binding domain 51.0 3.7e-12 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF00010.16.fs 1/1 9 60 .. 1 53 [] 49.0 1.8e-12 PF00010.16.ls 1/1 9 60 .. 1 53 [] 51.0 3.7e-12 Alignments of top-scoring domains: PF00010.16.fs: domain 1 of 1, from 9 to 60: score 49.0, E = 1.8e-12 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve Rr+h+a ERrRR +++d fe+L+ l ++s K+sK iL++A + KIAA0518 9 YRRTHTANERRRRGEMRDLFEKLKITLGL-LHSSKVSKSLILTRAFS 54 YIksLq<-* I+ L+ KIAA0518 55 EIQGLT 60 PF00010.16.ls: domain 1 of 1, from 9 to 60: score 51.0, E = 3.7e-12 *->rRrahnarERrRRdriNdafeeLrellPtlapskKlsKaeiLrlAve Rr+h+a ERrRR +++d fe+L+ l ++s K+sK iL++A + KIAA0518 9 YRRTHTANERRRRGEMRDLFEKLKITLGL-LHSSKVSKSLILTRAFS 54 YIksLq<-* I+ L+ KIAA0518 55 EIQGLT 60 //