hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/TIGRFAMs_HMM.LIB.bin
Sequence file:            /db/iprscan/tmp/20080502/iprscan-20080502-04075693/chunk_1/iprscan-20080502-04075693.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA0476
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
TIGR00756 PPR: pentatricopeptide repeat domain            26.4    3.3e-05   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
TIGR00756   1/1     944   978 ..     1    35 []    26.4  3.3e-05

Alignments of top-scoring domains:
TIGR00756: domain 1 of 1, from 944 to 978: score 26.4, E = 3.3e-05
                   *->vtYntlidglckagrveeAlelfdeMkerGikPdv<-*
                      v+Y +l+  +++ g++   ++++ eM+ +Gi+P++   
    KIAA0476   944    VCYRVLMQLCSHYGQPVLSVRVMLEMRQAGIVPNT    978  

//