hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01532297/chunk_1/iprscan-20080502-01532297.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0399 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00291 85.2 8.1e-21 2 SM00054 26.3 0.0042 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00054 1/1 136 164 .. 1 29 [] 26.3 0.0042 SM00291 1/2 1798 1846 .. 1 46 [] 39.9 3.5e-07 SM00291 2/2 1847 1891 .. 1 46 [] 45.3 8.1e-09 Alignments of top-scoring domains: SM00054: domain 1 of 1, from 136 to 164: score 26.3, E = 0.0042 *->elkeaFrefDkDgdGkIdfeEfkallksl<-* +++eaF+ fD+ gdG++d e ++++lk+ KIAA0399 136 QFEEAFAQFDAEGDGTVDAENMLEALKNS 164 SM00291: domain 1 of 2, from 1798 to 1846: score 39.9, E = 3.5e-07 *->vhhsvsCdgCgkepivgvRYkClvCpDYDLCesCfakGg....hhge + sCdgC + +RY+Cl+C+D DLC +Cf G+++++h+ + KIAA0399 1798 LNVDISCDGCDE-IAPWHRYRCLQCSDMDLCKTCFLGGVkpegHGDD 1843 Ham<-* H+m KIAA0399 1844 HEM 1846 SM00291: domain 2 of 2, from 1847 to 1891: score 45.3, E = 8.1e-09 *->vhhsvsCdgCgkepivgvRYkClvCpDYDLCesCfakGghhgeHam< v ++++Cd+C++ i+g R C+vC+D+DLC C+a+ ++++ H + KIAA0399 1847 VNMEFTCDHCQG-LIIGRRMNCNVCDDFDLCYGCYAAKKYSYGHLP 1891 -* KIAA0399 - - //