hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-01450231/chunk_1/iprscan-20080502-01450231.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0394 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00055 98.6 7.1e-25 1 SM00456 53.1 3.7e-11 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00456 1/1 19 51 .. 1 34 [] 53.1 3.7e-11 SM00055 1/1 151 237 .. 1 103 [] 98.6 7.1e-25 Alignments of top-scoring domains: SM00456: domain 1 of 1, from 19 to 51: score 53.1, E = 3.7e-11 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* lPpgW + +p+ Gr YY+N++T et+We+P + KIAA0394 19 ILPPGWQSYLSPQ-GRRYYVNTTTNETTWERPSS 51 SM00055: domain 1 of 1, from 151 to 237: score 98.6, E = 7.1e-25 *->mgfwselwsddGfeaLlsrlknglrlledlkkflreRakiEeeYAkk + +++ + ++Gfe Ll+ + g+++ +++ +f+reR+kiEe+YAk+ KIAA0394 151 DPQGNGT--VAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKN 195 Lqklskkyfnkkssvgdlravreteselgslkkswevllsetdalakshl L+kls +++ ++e+gsl+++w++++ +++++a++hl KIAA0394 196 LAKLS--------------QNSLASQEEGSLGEAWAQVKKSLADEAEVHL 231 qlsedL<-* ++s +L KIAA0394 232 KFSAKL 237 //