hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080502/iprscan-20080502-00074436/chunk_1/iprscan-20080502-00074436.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0336 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00755 83.8 2.1e-20 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00755 1/1 1563 1610 .. 1 50 [] 83.8 2.1e-20 Alignments of top-scoring domains: SM00755: domain 1 of 1, from 1563 to 1610: score 83.8, E = 2.1e-20 *->eeanfEYLKNVllqFLtlresdnaeretLlpVistvLqlSpeEmqkl + an+EYLKNVllqF++l++++ ere+LlpVi+t+LqlSpeE+ kl KIAA0336 1563 SAANLEYLKNVLLQFIFLKPGS--ERERLLPVINTMLQLSPEEKGKL 1607 lev<-* +v KIAA0336 1608 AAV 1610 //