hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23442909/chunk_1/iprscan-20080501-23442909.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0324 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF08312.2.fs cwf21 89.6 7.8e-26 1 PF08312.2.ls cwf21 91.6 2.2e-24 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF08312.2.fs 1/1 99 143 .. 1 46 [] 89.6 7.8e-26 PF08312.2.ls 1/1 99 143 .. 1 46 [] 91.6 2.2e-24 PF02178.9.ls 2/6 1541 1553 .. 1 13 [] 6.0 1.9 Alignments of top-scoring domains: PF08312.2.fs: domain 1 of 1, from 99 to 143: score 89.6, E = 7.8e-26 *->rkpdkEIleHerKRkIEVKclELrdeLEEqGleneeEIEekVnelR< ++p+++Il+HerKR++E++clEL++++EEqG+e e+ I+ekV+++R KIAA0324 99 KRPNPDILDHERKRRVELRCLELEEMMEEQGYE-EQQIQEKVATFR 143 -* KIAA0324 - - PF08312.2.ls: domain 1 of 1, from 99 to 143: score 91.6, E = 2.2e-24 *->rkpdkEIleHerKRkIEVKclELrdeLEEqGleneeEIEekVnelR< ++p+++Il+HerKR++E++clEL++++EEqG+e e+ I+ekV+++R KIAA0324 99 KRPNPDILDHERKRRVELRCLELEEMMEEQGYE-EQQIQEKVATFR 143 -* KIAA0324 - - PF02178.9.ls: domain 2 of 6, from 1541 to 1553: score 6.0, E = 1.9 *->kRkRGRPrKaata<-* +R+R R + +++ KIAA0324 1541 PRPRSRSPSSPEL 1553 //