hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23213987/chunk_1/iprscan-20080501-23213987.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0311 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00150 41.0 1.5e-07 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00150 1/3 787 888 .. 1 104 [] 18.5 0.19 SM00150 2/3 967 1065 .. 1 104 [] 2.4 5.3 SM00150 3/3 1086 1194 .. 1 104 [] 20.2 0.13 Alignments of top-scoring domains: SM00150: domain 1 of 3, from 787 to 888: score 18.5, E = 0.19 *->qqFlrdadeleaWleeke.qllssedlgeskDlesveallkkHqale + F ++de+++Wl+e++++ + +++ ++++ l+ H ++ KIAA0311 787 EGFVNKLDEFIQWLNEAMeTTENWTPPK--AEMDDLKLYLETHLSFK 831 aelaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlela ++ h + +a++e+g qL+e +++ +++ l+ + ++W+eL+++ KIAA0311 832 LNVDSHCALKEAVEEEGHQLLEL-IASHKAGLKDMLRMIASQWKELQRQI 880 eeRrqkLe<-* ++++ + KIAA0311 881 KRQHSWIL 888 SM00150: domain 2 of 3, from 967 to 1065: score 2.4, E = 5.3 *->qqFlrdadeleaWleekeqllssedlgeskDlesveallk.kHqale F ++ +el +Wl ++e l+ +d +Dl e+++++ ++ KIAA0311 967 LDFDSEYQELWDWLIDMESLV--MDS---HDLMMSEEQQQhLYKRYS 1008 aelaaheervdalnelgeqLieesghpdaeeIeerleelnerWeeLlela e++ ++ + +l e+L++ g ++ e+++ +ne+We L + + KIAA0311 1009 VEMSIRHLKKTELLSKVEALKKG-GVLLPNDLLEKVDSINEKWELLGKTL 1057 eeRrqkLe<-* e+ q KIAA0311 1058 GEKIQDTM 1065 SM00150: domain 3 of 3, from 1086 to 1194: score 20.2, E = 0.13 *->qqFlrdadeleaWleeke....qllssedlgeskDlesveallkkHq +q+ ++el+ Wl+++e + ++ + e++l+ ++ KIAA0311 1086 RQLEVRIKELKGWLRDTElfifNSCLRQEK---EGTMNTEKQLQYFK 1129 aleaelaaheervdalnelgeqLiee....sghpdaeeIeerleelnerW l +e+++++ v ++ +l++ L++++++ ++d + + + +l++rW KIAA0311 1130 SLCREIKQRRRGVASILRLCQHLLDDretcNLNADHQPMQLIIVNLERRW 1179 eeLlelaeeRrqkLe<-* e++ +a +++ +L+ KIAA0311 1180 EAIVMQAVQWQTRLQ 1194 //