hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/TIGRFAMs_HMM.LIB.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-23130622/chunk_1/iprscan-20080501-23130622.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0307 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- TIGR00229 sensory_box: PAS domain S-box 20.1 0.0027 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- TIGR00229 1/1 320 447 .. 1 130 [] 20.1 0.0027 Alignments of top-scoring domains: TIGR00229: domain 1 of 1, from 320 to 447: score 20.1, E = 0.0027 *->reseeryraifesspdaiivvdleGnilyvnpafeelfGysaeellG + + + + ++++G+i++v p+ + Gy +++llG KIAA0307 320 SSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLG 366 rnvlelipeedreelrerierlletgerepvseerrvlgrrkdGseiwve + +le+ ++ed +lre ++++ + ++++ s +r+ r+k+ + w++ KIAA0307 367 KDILEFCHPEDQSHLRESFQQVVK-LKGQVLSVMYRF--RTKN--REWML 411 vsvspirdsn...ggvlgvlgivrDiterkeaeeal<-* +++s+ +n+ + ++ +++++ ++ ++++ + +l KIAA0307 412 IRTSSFTFQNpysDEIEYIICTNTNVKQLQQQQAEL 447 //