hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /db/iprscan/data/smart.HMMs.bin
Sequence file:            /db/iprscan/tmp/20080501/iprscan-20080501-22465188/chunk_1/iprscan-20080501-22465188.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: KIAA0293
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00389                                                  59.2    5.5e-13   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00389    1/1    1187  1249 ..     1    63 []    59.2  5.5e-13

Alignments of top-scoring domains:
SM00389: domain 1 of 1, from 1187 to 1249: score 59.2, E = 5.5e-13
                   *->krrkRtsftpeQleeLEkeFeknpYPsreereeLAkeLgLterqVkv
                       +++R ++ pe  e+L+k+++  pYPs +++e L+ +L+L    V +
    KIAA0293  1187    IKKPRVVLAPEEKEALRKAYQLEPYPSQQTIELLSFQLNLKTNTVIN 1233 

                   WFQNRRakwkrqekkk<-*
                   WF N R +++r++  +   
    KIAA0293  1234 WFHNYRSRMRREMLVE    1249 

//