hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-20524479/chunk_1/iprscan-20080501-20524479.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0227 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00028 41.1 1.5e-07 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00028 1/3 171 204 .. 1 34 [] 6.1 1e+02 SM00028 2/3 242 277 .. 1 34 [] 6.0 1e+02 SM00028 3/3 278 311 .. 1 34 [] 29.0 0.00064 Alignments of top-scoring domains: SM00028: domain 1 of 3, from 171 to 204: score 6.1, E = 1e+02 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* a ++ +G ++k +++ eAi y +AL KIAA0227 171 AHEFKSQGAQCYKDKKFREAIGKYHRALLELKGL 204 SM00028: domain 2 of 3, from 242 to 277: score 6.0, E = 1e+02 *->aealynlGnaylklg..dydeAieyyekALeldPnn<-* +++++ l+ ++l+ + +y+ ey+ k+L+ + +n KIAA0227 242 IDCYNSLAACLLQAElvNYERVKEYCLKVLKKEGEN 277 SM00028: domain 3 of 3, from 278 to 311: score 29.0, E = 0.00064 *->aealynlGnaylklgdydeAieyyekALeldPnn<-* +aly+ G+a+++lgdyd+A+ y+++A + +P++ KIAA0227 278 FKALYRSGVAFYHLGDYDKALYYLKEARTQQPTD 311 //