hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-20524479/chunk_1/iprscan-20080501-20524479.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0227 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07719.7.fs Tetratricopeptide repeat 36.6 3.3e-09 2 PF07719.7.ls Tetratricopeptide repeat 40.6 5.1e-09 2 PF00515.18.ls Tetratricopeptide repeat 35.3 1.9e-07 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07719.7.fs 2/2 278 311 .. 1 34 [] 29.7 2.7e-07 PF00515.18.ls 3/3 278 311 .. 1 34 [] 30.4 5.8e-06 PF07719.7.ls 2/2 278 311 .. 1 34 [] 31.7 2.4e-06 Alignments of top-scoring domains: PF07719.7.fs: domain 2 of 2, from 278 to 311: score 29.7, E = 2.7e-07 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ++aly+ G+a y+lgdy++Al ++++A P++ KIAA0227 278 FKALYRSGVAFYHLGDYDKALYYLKEARTQQPTD 311 PF00515.18.ls: domain 3 of 3, from 278 to 311: score 30.4, E = 5.8e-06 *->aeayynlGnaylklgkydeAieayekALeldPnn<-* +a+y+ G+a+++lg+yd+A+ ++++A +P++ KIAA0227 278 FKALYRSGVAFYHLGDYDKALYYLKEARTQQPTD 311 PF07719.7.ls: domain 2 of 2, from 278 to 311: score 31.7, E = 2.4e-06 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ++aly+ G+a y+lgdy++Al ++++A P++ KIAA0227 278 FKALYRSGVAFYHLGDYDKALYYLKEARTQQPTD 311 //