hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-19574248/chunk_1/iprscan-20080501-19574248.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0194 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00398 68.7 7.1e-16 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00398 1/1 184 254 .. 1 71 [] 68.7 7.1e-16 Alignments of top-scoring domains: SM00398: domain 1 of 1, from 184 to 254: score 68.7, E = 7.1e-16 *->kpKrPmsafmlFsqenRakikkenPdlknaeisKklgerWkeLseee k+K+P+sa++l++ + + k+++e P+l+++ei+Kk++e W++Ls +e KIAA0194 184 KTKKPRSAYLLYYYDIYLKVQQELPHLPQSEINKKISESWRLLSVAE 230 KapYeekAekdkeryekempeykk<-* + +Y ekA+ +ke + + + KIAA0194 231 RSYYLEKAKLEKEGLDPNSKLSAL 254 //