hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-17273347/chunk_1/iprscan-20080501-17273347.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0103 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF07719.7.fs Tetratricopeptide repeat 50.7 3.5e-13 3 PF07719.7.ls Tetratricopeptide repeat 49.7 9.3e-12 3 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF07719.7.ls 1/3 89 122 .. 1 34 [] 21.9 0.0021 PF07719.7.ls 2/3 157 190 .. 1 34 [] 24.7 0.0003 Alignments of top-scoring domains: PF07719.7.ls: domain 1 of 3, from 89 to 122: score 21.9, E = 0.0021 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ++ ++ G+ +++++y++A+++y++ l+ dP+n KIAA0103 89 HRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTN 122 PF07719.7.ls: domain 2 of 3, from 157 to 190: score 24.7, E = 0.0003 *->aealynlGlayyklgdyeeAleayekAleldPnn<-* ea++ l+++y++ dy++A+ ++e+ +P+n KIAA0103 157 QEAWHELAELYINEHDYAKAAFCLEELMMTNPHN 190 //