hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-16523560/chunk_1/iprscan-20080501-16523560.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0082 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00443 53.5 2.7e-11 1 SM00456 37.0 2.5e-06 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00443 1/1 132 178 .. 1 48 [] 53.5 2.7e-11 SM00456 1/1 800 833 .. 1 34 [] 37.0 2.5e-06 Alignments of top-scoring domains: SM00443: domain 1 of 1, from 132 to 178: score 53.5, E = 2.7e-11 *->istsniGaklLekMGWkeGkGLGkneqGivePIeakikkkdrkGLGa ++++++kl++kMG++eG+GLGk qG+++ +ea + k r+GLG KIAA0082 132 SMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQ-KGRRGLGL 177 v<-* KIAA0082 178 T 178 SM00456: domain 1 of 1, from 800 to 833: score 37.0, E = 2.5e-06 *->plPpgWeerkdpdsGrpYYyNheTketqWekPre<-* +++++W++ ++++++++++yN++Tk ++++ P++ KIAA0082 800 TVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPAD 833 //