hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/smart.HMMs.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15230964/chunk_1/iprscan-20080501-15230964.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0029 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- SM00393 89.1 5.3e-22 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- SM00393 1/1 110 187 .. 1 83 [] 89.1 5.3e-22 Alignments of top-scoring domains: SM00393: domain 1 of 1, from 110 to 187: score 89.1, E = 5.3e-22 *->adflpllldiesyrprrreelielaleiakffvkstkesvelpPsMn +d++ +l+++++++pr+r++l++l++ei++f++++++ ++++pP M+ KIAA0029 110 IDLHEFLVNTLKNNPRDRMMLLKLEQEILDFIGNNESPRKKFPP-MT 155 syeRkivHelaekygLeSeSeGegpkeNRrvvvskk<-* sy+R++ H++a ++gL +++ ++g ++v+v k+ KIAA0029 156 SYHRMLLHRVAAYFGLDHNVDQSG----KSVIVNKT 187 //