hmmpfam - search one or more sequences against HMM database HMMER 2.3.2 (Oct 2003) Copyright (C) 1992-2003 HHMI/Washington University School of Medicine Freely distributed under the GNU General Public License (GPL) - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /db/iprscan/data/Pfam.bin Sequence file: /db/iprscan/tmp/20080501/iprscan-20080501-15024197/chunk_1/iprscan-20080501-15024197.nocrc - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query sequence: KIAA0018 Accession: [none] Description: [none] Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- PF01565.13.fs FAD binding domain 51.8 4.5e-14 1 PF01565.13.ls FAD binding domain 21.1 8.3e-05 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- PF01565.13.ls 1/1 101 240 .. 1 144 [] 21.1 8.3e-05 PF01565.13.fs 1/1 151 240 .. 49 144 .] 51.8 4.5e-14 Alignments of top-scoring domains: PF01565.13.ls: domain 1 of 1, from 101 to 240: score 21.1, E = 8.3e-05 *->P.aavvrPeseeevaaivrlArehgipvtprGgGhslsfGgavplnt P++ r+++++ ++ ++ + + t r g +s+ + + KIAA0018 101 PrLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYK-K 146 gG..vvldlsrklnriileiDpetdgtatveaGvtl.dLnralaakGlfl ++++++l ++ ile+D + +++ve+ vt++++ + l G++l KIAA0018 147 THknIMINL---MD--ILEVDTK-KQIVRVEPLVTMgQVTALLTSIGWTL 190 pldpgsgipgtvGGaiatnagGygsekyGltrdnvlglevVladGevvrl p+ p + tvGG+i + ++ + s+kyGl+ + +++ e+VladG+ vr+ KIAA0018 191 PVLPELDDL-TVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRC 239 s<-* + KIAA0018 240 T 240 PF01565.13.fs: domain 1 of 1, from 151 to 240: score 51.8, E = 4.5e-14 *->vvldlsrklnriileiDpetdgtatveaGvtl.dLnralaakGlflp ++++l ++ ile+D + +++ve+ vt++++ + l G++lp KIAA0018 151 IMINL---MD--ILEVDTK-KQIVRVEPLVTMgQVTALLTSIGWTLP 191 ldpgsgipgtvGGaiatnagGygsekyGltrdnvlglevVladGevvrls + p + tvGG+i + ++ + s+kyGl+ + +++ e+VladG+ vr++ KIAA0018 192 VLPELDDL-TVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRCT 240 <-* KIAA0018 - - //