Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC017028A_C01 KMC017028A_c01
(573 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|XP_236056.1| similar to hypothetical protein FLJ21044 simila... 32 5.7
>ref|XP_236056.1| similar to hypothetical protein FLJ21044 similar to Rbig1 [Homo
sapiens] [Rattus norvegicus]
Length = 453
Score = 32.0 bits (71), Expect = 5.7
Identities = 17/54 (31%), Positives = 28/54 (51%)
Frame = -1
Query: 420 APVISSISQQKPLTLASSLHPSRTIGLDIHLPSVCEESMARFRSSGTPSLQLLC 259
+P+ S+S P S L PS + +H P VC+ S+ + S +PS+ + C
Sbjct: 351 SPLSPSVSVHSPPVCVSPLSPS----VSVHCPPVCQSSVLQCVSPLSPSVSVHC 400
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 473,579,167
Number of Sequences: 1393205
Number of extensions: 9648360
Number of successful extensions: 19195
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 18734
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19192
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 21243732558
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
