Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC013400A_C01 KMC013400A_c01
(538 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
emb|CAD38696.1| hypothetical protein [Homo sapiens] 33 1.7
>emb|CAD38696.1| hypothetical protein [Homo sapiens]
Length = 996
Score = 33.5 bits (75), Expect = 1.7
Identities = 15/54 (27%), Positives = 23/54 (41%)
Frame = +2
Query: 230 LWQADITSCFCGRAELIQDSERTRSSQHAGCLHSPKTALVQHHLQ*WLLVNQAS 391
+WQ + C L+ E + +H H K +V H + WLL+ AS
Sbjct: 421 VWQPEFEDCEKPERTLVVQDEEITAHKHIKPWHKAKELIVNHEKEHWLLIQDAS 474
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 434,454,194
Number of Sequences: 1393205
Number of extensions: 8698673
Number of successful extensions: 17772
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17771
length of database: 448,689,247
effective HSP length: 115
effective length of database: 288,470,672
effective search space used: 18173652336
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)