Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC009890A_C01 KMC009890A_c01
(548 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|ZP_00076127.1| hypothetical protein [Methanosarcina barkeri] 31 8.6
>gb|ZP_00076127.1| hypothetical protein [Methanosarcina barkeri]
Length = 574
Score = 31.2 bits (69), Expect = 8.6
Identities = 18/43 (41%), Positives = 26/43 (59%), Gaps = 5/43 (11%)
Frame = -3
Query: 345 DQGTWYFATS-----LYWLQINNSRHEVEQGQLRGLLVELDAA 232
++G F TS LY +Q ++S ++EQ +L GLL ELD A
Sbjct: 170 NEGQLIFITSDTLLHLYHVQFDDSMSQIEQNKLYGLLWELDKA 212
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 492,700,811
Number of Sequences: 1393205
Number of extensions: 10330921
Number of successful extensions: 21787
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 21300
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21786
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 18947112822
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)