Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC007937A_C01 KMC007937A_c01
(481 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_196175.1| E3 ubiquitin ligase APC1, putative; protein id:... 32 3.6
>ref|NP_196175.1| E3 ubiquitin ligase APC1, putative; protein id: At5g05560.1
[Arabidopsis thaliana] gi|10178133|dbj|BAB11545.1|
meiotic check point regulator-like protein [Arabidopsis
thaliana]
Length = 1678
Score = 32.0 bits (71), Expect = 3.6
Identities = 18/63 (28%), Positives = 32/63 (50%)
Frame = -2
Query: 360 WYFIISTCYFESYSIMYPGLHSINRLSLKEWHNQFQRRKCNALTQSRVLHVEAPNLSCLR 181
W F++ + + ++YS + G+ SINRL L E F + C+ T + +L CL
Sbjct: 529 WEFLLISKFHKTYSRFHNGITSINRLDL-EGIVPFDSKICSEETLGSSCELMVQSLDCLH 587
Query: 180 SFH 172
+ +
Sbjct: 588 AVY 590
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 406,045,976
Number of Sequences: 1393205
Number of extensions: 7839224
Number of successful extensions: 15166
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14888
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15159
length of database: 448,689,247
effective HSP length: 113
effective length of database: 291,257,082
effective search space used: 13397825772
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)