Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC007646A_C01 KMC007646A_c01
(553 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_404297.1| conserved hypothetical protein [Yersinia pestis... 33 3.0
>ref|NP_404297.1| conserved hypothetical protein [Yersinia pestis]
gi|22127393|ref|NP_670816.1| hypothetical protein
[Yersinia pestis KIM] gi|25322886|pir||AF0081 conserved
hypothetical protein YPO0659 [imported] - Yersinia
pestis (strain CO92) gi|15978749|emb|CAC89513.1|
conserved hypothetical protein [Yersinia pestis CO92]
gi|21960481|gb|AAM87067.1|AE013955_1 hypothetical
protein [Yersinia pestis KIM]
Length = 260
Score = 32.7 bits (73), Expect = 3.0
Identities = 21/70 (30%), Positives = 34/70 (48%)
Frame = +1
Query: 97 IMARGNMKHNSPKGKFTSKRGHLPLLLPCSECIQDQASCISYQG*GHVNTNLPTHKGR*N 276
I+A GN+ HN GK+ + P ++ ++D +SYQG H N H+G
Sbjct: 160 IVASGNVVHNLRLGKWQGESSPYPWAESFNQFVRDN---LSYQGDDHPLVNFMQHEGA-- 214
Query: 277 AFSILNSSPQ 306
++ N SP+
Sbjct: 215 --ALSNPSPE 222
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 482,584,622
Number of Sequences: 1393205
Number of extensions: 10374848
Number of successful extensions: 22449
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 21891
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22448
length of database: 448,689,247
effective HSP length: 116
effective length of database: 287,077,467
effective search space used: 19234190289
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)