Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC005524A_C01 KMC005524A_c01
(578 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|EAA17109.1| hypothetical protein [Plasmodium yoelii yoelii] 33 3.3
>gb|EAA17109.1| hypothetical protein [Plasmodium yoelii yoelii]
Length = 622
Score = 32.7 bits (73), Expect = 3.3
Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Frame = +3
Query: 96 ITKSLTNNVPRKLTRGNLGKNIIARNINNINLKGV-IHTIINMAMFERLKYN 248
I+ +NN+ T+GN N+I + INN N+ V IH++ N K N
Sbjct: 43 ISIGASNNIHHITTQGNTNNNMIGQGINNYNVSSVNIHSMGNNIGMNHTKMN 94
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 441,311,022
Number of Sequences: 1393205
Number of extensions: 8715495
Number of successful extensions: 15742
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15172
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15712
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 21426319650
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
