Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC003397A_C01 KMC003397A_c01
(494 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|NP_050198.1| immediate-early protein 6 [Human herpesvirus 6B... 33 1.3
>ref|NP_050198.1| immediate-early protein 6 [Human herpesvirus 6B]
gi|11281976|pir||T43978 hypothetical protein U18
[imported] - human herpesvirus 6
gi|4996006|dbj|BAA78239.1| 88.7% identical to U18 gene
of strain U1102 of HHV-6~IE-B, homologous to HCMV IE
glycoprotein [Human herpesvirus 6]
gi|5733527|gb|AAD49630.1|AF157706_19 U18 [Human
herpesvirus 6B]
Length = 294
Score = 33.5 bits (75), Expect = 1.3
Identities = 16/42 (38%), Positives = 22/42 (52%)
Frame = -3
Query: 300 HSFYFPPTKNYVMVR*FFSHCFKSWWRHWLRYTLVNRLLSNS 175
HS YF KN M + F + +KS W +W +Y + LL S
Sbjct: 203 HSKYFSLIKNDTMPKKFLRNTWKSAWTNWYKYKEIEALLDFS 244
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 387,052,044
Number of Sequences: 1393205
Number of extensions: 7444642
Number of successful extensions: 15317
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 14980
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15298
length of database: 448,689,247
effective HSP length: 114
effective length of database: 289,863,877
effective search space used: 14493193850
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
