Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC002133A_C01 KMC002133A_c01
(373 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|AAK95623.1| spheroidin [Oedaleus asiaticus entomopoxvirus] 30 9.9
>gb|AAK95623.1| spheroidin [Oedaleus asiaticus entomopoxvirus]
Length = 988
Score = 29.6 bits (65), Expect = 9.9
Identities = 20/65 (30%), Positives = 35/65 (53%)
Frame = +2
Query: 128 TLLFSFV*NNILYLQVKSWRVLALVETQLLIIY*KSIILNLQL*LQNVILEEAKIMQDYN 307
TL+FSF N+I+ + + +LV+T L + KS++LN L + V+ ++
Sbjct: 77 TLVFSF--NSIVDKDQLTSYLTSLVKTNLAPLNGKSVVLNTNLLINGVVDNSYACTHNFW 134
Query: 308 LLFHN 322
L+ HN
Sbjct: 135 LVVHN 139
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 311,582,703
Number of Sequences: 1393205
Number of extensions: 6091430
Number of successful extensions: 11785
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11781
length of database: 448,689,247
effective HSP length: 99
effective length of database: 310,761,952
effective search space used: 7458286848
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
