Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC001124A_C01 KMC001124A_c01
(582 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|AAN63466.1|AF314061_1 methyltransferase/helicase polyprotein ... 32 7.6
>gb|AAN63466.1|AF314061_1 methyltransferase/helicase polyprotein [grapevine rootstock stem
lesion associated virus]
Length = 2931
Score = 31.6 bits (70), Expect = 7.6
Identities = 19/56 (33%), Positives = 31/56 (54%)
Frame = +3
Query: 228 FKCLRKQQRIRLDRHTNDRSIELNSTNHFESLSEIMRILQEWQCRGRNPLYEHLCN 395
F C+ QQRI+ H D ++ N +E+LS IMR+L +G + ++ +L N
Sbjct: 1426 FSCVADQQRIKSYVHYLDTAVSFLDQN-YENLSFIMRVLS----KGYSCMFSYLAN 1476
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 460,925,457
Number of Sequences: 1393205
Number of extensions: 9137179
Number of successful extensions: 17047
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16642
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17044
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 21712003912
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
