Nr search
BLASTX 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= KMC000350A_C02 KMC000350A_c02
(845 letters)
Database: nr
1,393,205 sequences; 448,689,247 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|EAA36824.1| GLP_398_8064_6286 [Giardia lamblia ATCC 50803] 32 9.0
>gb|EAA36824.1| GLP_398_8064_6286 [Giardia lamblia ATCC 50803]
Length = 592
Score = 32.3 bits (72), Expect = 9.0
Identities = 21/53 (39%), Positives = 31/53 (57%), Gaps = 3/53 (5%)
Frame = -2
Query: 244 SPLLSLHLVSGLMPLFYSTS---LFPSISPXMVVSNPYLL*QILSLLFQNEGL 95
S LL + +GL L+ S LF SI P + +++ LL +LSL+ +NEGL
Sbjct: 231 SSLLPPSVCNGLETLYRQVSSAELFDSIDPKIALASCDLLLDLLSLILKNEGL 283
Database: nr
Posted date: Apr 1, 2003 2:05 AM
Number of letters in database: 448,689,247
Number of sequences in database: 1,393,205
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 718,342,447
Number of Sequences: 1393205
Number of extensions: 15478365
Number of successful extensions: 29627
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 28875
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29616
length of database: 448,689,247
effective HSP length: 122
effective length of database: 278,718,237
effective search space used: 44316199683
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
