
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= AC149574.8 + phase: 0 /pseudo
(868 letters)
Database: uniref100
2,790,947 sequences; 848,049,833 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef100_UPI0000314433 UPI0000314433 UniRef100 entry 37 2.6
>UniRef100_UPI0000314433 UPI0000314433 UniRef100 entry
Length = 185
Score = 37.0 bits (84), Expect = 2.6
Identities = 15/39 (38%), Positives = 27/39 (68%)
Query: 767 VKIHDSAHPKELWFILRKNGCNNNLRR*YNMHRSVERRI 805
V + S HPKEL+++L K NN+++ ++++S+ER I
Sbjct: 127 VSLLKSKHPKELYYLLSKKDFENNIKKILHVNQSIERNI 165
Database: uniref100
Posted date: Jan 5, 2005 1:24 AM
Number of letters in database: 848,049,833
Number of sequences in database: 2,790,947
Lambda K H
0.372 0.163 0.676
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,109,974,058
Number of Sequences: 2790947
Number of extensions: 35599910
Number of successful extensions: 130825
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 130824
Number of HSP's gapped (non-prelim): 1
length of query: 868
length of database: 848,049,833
effective HSP length: 136
effective length of query: 732
effective length of database: 468,481,041
effective search space: 342928122012
effective search space used: 342928122012
T: 11
A: 40
X1: 14 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (22.0 bits)
S2: 79 (35.0 bits)
Medicago: description of AC149574.8