Medicago
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC149039.1 + phase: 0 /pseudo
         (434 letters)

Database: uniref100 
           2,790,947 sequences; 848,049,833 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

UniRef100_UPI00002F9BF7 UPI00002F9BF7 UniRef100 entry                  34  9.3

>UniRef100_UPI00002F9BF7 UPI00002F9BF7 UniRef100 entry
          Length = 1976

 Score = 33.9 bits (76), Expect = 9.3
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 92   GPMLQGILCQGSCYGQVTTGWPWSMIATSTPESATNVKSMLIRFMCLRTLSMLFHPHGRS 151
            GP   G + +  C    + G P     T  PE+AT+  S L    C+  +   F PH R 
Sbjct: 1813 GPHGDGAIPRECCDCSASAGGPAGAQVTPDPEAATHHISHLFPVECVLGVKFCFRPH-RG 1871

Query: 152  QCGAST*LEELNRRL 166
              GA    ++L RRL
Sbjct: 1872 FGGAGRRRQKLRRRL 1886


  Database: uniref100
    Posted date:  Jan 5, 2005  1:24 AM
  Number of letters in database: 848,049,833
  Number of sequences in database:  2,790,947
  
Lambda     K      H
   0.354    0.153    0.564 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 584,712,358
Number of Sequences: 2790947
Number of extensions: 19725928
Number of successful extensions: 66051
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 66051
Number of HSP's gapped (non-prelim): 1
length of query: 434
length of database: 848,049,833
effective HSP length: 130
effective length of query: 304
effective length of database: 485,226,723
effective search space: 147508923792
effective search space used: 147508923792
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.6 bits)
S2: 76 (33.9 bits)


Medicago: description of AC149039.1