
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= AC149039.1 + phase: 0 /pseudo
(434 letters)
Database: uniref100
2,790,947 sequences; 848,049,833 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef100_UPI00002F9BF7 UPI00002F9BF7 UniRef100 entry 34 9.3
>UniRef100_UPI00002F9BF7 UPI00002F9BF7 UniRef100 entry
Length = 1976
Score = 33.9 bits (76), Expect = 9.3
Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 1/75 (1%)
Query: 92 GPMLQGILCQGSCYGQVTTGWPWSMIATSTPESATNVKSMLIRFMCLRTLSMLFHPHGRS 151
GP G + + C + G P T PE+AT+ S L C+ + F PH R
Sbjct: 1813 GPHGDGAIPRECCDCSASAGGPAGAQVTPDPEAATHHISHLFPVECVLGVKFCFRPH-RG 1871
Query: 152 QCGAST*LEELNRRL 166
GA ++L RRL
Sbjct: 1872 FGGAGRRRQKLRRRL 1886
Database: uniref100
Posted date: Jan 5, 2005 1:24 AM
Number of letters in database: 848,049,833
Number of sequences in database: 2,790,947
Lambda K H
0.354 0.153 0.564
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 584,712,358
Number of Sequences: 2790947
Number of extensions: 19725928
Number of successful extensions: 66051
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 66051
Number of HSP's gapped (non-prelim): 1
length of query: 434
length of database: 848,049,833
effective HSP length: 130
effective length of query: 304
effective length of database: 485,226,723
effective search space: 147508923792
effective search space used: 147508923792
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.6 bits)
S2: 76 (33.9 bits)
Medicago: description of AC149039.1