BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC146791.7 + phase: 0 /pseudo
         (694 letters)

Database: uniref100 
           2,790,947 sequences; 848,049,833 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

UniRef100_Q9S212 Hypothetical protein SCO1788 [Streptomyces coel...    35  9.8

>UniRef100_Q9S212 Hypothetical protein SCO1788 [Streptomyces coelicolor]
          Length = 343

 Score = 34.7 bits (78), Expect = 9.8
 Identities = 22/60 (36%), Positives = 27/60 (44%), Gaps = 3/60 (5%)

Query: 469 GGWRMGAGVVLFGGRRLVGLEEGRVGAVLDGLRVVWLGVWVMGRILCFGMSGGVEMSLSG 528
           GG+R G      GG RL   E    GA LDGLRV+    W  G     G+  G  ++  G
Sbjct: 286 GGFRCGGWTATAGGERL---ELDGDGAALDGLRVLCAAAWTAGGEQGCGLDSGKALARLG 342


  Database: uniref100
    Posted date:  Jan 5, 2005  1:24 AM
  Number of letters in database: 848,049,833
  Number of sequences in database:  2,790,947
  
Lambda     K      H
   0.370    0.171    0.670 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 939,537,566
Number of Sequences: 2790947
Number of extensions: 35319686
Number of successful extensions: 198775
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 198774
Number of HSP's gapped (non-prelim): 1
length of query: 694
length of database: 848,049,833
effective HSP length: 134
effective length of query: 560
effective length of database: 474,062,935
effective search space: 265475243600
effective search space used: 265475243600
T: 11
A: 40
X1: 14 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (21.7 bits)
S2: 78 (34.7 bits)