Medicago
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC144475.2 - phase: 0 /pseudo
         (656 letters)

Database: uniref100 
           2,790,947 sequences; 848,049,833 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

UniRef100_UPI000032AC44 UPI000032AC44 UniRef100 entry                  35  9.2

>UniRef100_UPI000032AC44 UPI000032AC44 UniRef100 entry
          Length = 286

 Score = 34.7 bits (78), Expect = 9.2
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 29  YLIYFLLMIYFFLQRPQLNRLIVFCIALIFFVKPLVKR*IEIK 71
           YL Y+ L+ + F+  P ++ LI+F    IF+ K L+KR  +IK
Sbjct: 196 YLPYYYLIFWIFISTPVIH-LILFLTGFIFYSKRLIKRFFQIK 237


  Database: uniref100
    Posted date:  Jan 5, 2005  1:24 AM
  Number of letters in database: 848,049,833
  Number of sequences in database:  2,790,947
  
Lambda     K      H
   0.356    0.161    0.537 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 850,774,699
Number of Sequences: 2790947
Number of extensions: 30115282
Number of successful extensions: 154725
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 154725
Number of HSP's gapped (non-prelim): 1
length of query: 656
length of database: 848,049,833
effective HSP length: 134
effective length of query: 522
effective length of database: 474,062,935
effective search space: 247460852070
effective search space used: 247460852070
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.6 bits)
S2: 78 (34.7 bits)


Medicago: description of AC144475.2