
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= AC144475.2 - phase: 0 /pseudo
(656 letters)
Database: uniref100
2,790,947 sequences; 848,049,833 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef100_UPI000032AC44 UPI000032AC44 UniRef100 entry 35 9.2
>UniRef100_UPI000032AC44 UPI000032AC44 UniRef100 entry
Length = 286
Score = 34.7 bits (78), Expect = 9.2
Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
Query: 29 YLIYFLLMIYFFLQRPQLNRLIVFCIALIFFVKPLVKR*IEIK 71
YL Y+ L+ + F+ P ++ LI+F IF+ K L+KR +IK
Sbjct: 196 YLPYYYLIFWIFISTPVIH-LILFLTGFIFYSKRLIKRFFQIK 237
Database: uniref100
Posted date: Jan 5, 2005 1:24 AM
Number of letters in database: 848,049,833
Number of sequences in database: 2,790,947
Lambda K H
0.356 0.161 0.537
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 850,774,699
Number of Sequences: 2790947
Number of extensions: 30115282
Number of successful extensions: 154725
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 154725
Number of HSP's gapped (non-prelim): 1
length of query: 656
length of database: 848,049,833
effective HSP length: 134
effective length of query: 522
effective length of database: 474,062,935
effective search space: 247460852070
effective search space used: 247460852070
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.6 bits)
S2: 78 (34.7 bits)
Medicago: description of AC144475.2