BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC126782.17 - phase: 0 /pseudo
         (346 letters)

Database: uniref100 
           2,790,947 sequences; 848,049,833 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

UniRef100_Q6ZI97 Hypothetical protein OJ1770_H02.35 [Oryza sativa]     79  1e-13

>UniRef100_Q6ZI97 Hypothetical protein OJ1770_H02.35 [Oryza sativa]
          Length = 207

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 37/63 (58%), Positives = 48/63 (75%), Gaps = 2/63 (3%)

Query: 7  ASMEQTLWGH--LPVLLNVSSKESIEFILQALWRTRKTGLQSDDRCIIQDMLQLQNDYDL 64
          A+    LWGH  LP+L   SSKES+E+ILQALWRTR+TGL + DR +++DML L +D DL
Sbjct: 7  AAAAAALWGHKHLPLLARASSKESVEYILQALWRTRRTGLDAADRAVVRDMLHLASDADL 66

Query: 65 DPV 67
          DP+
Sbjct: 67 DPL 69


  Database: uniref100
    Posted date:  Jan 5, 2005  1:24 AM
  Number of letters in database: 848,049,833
  Number of sequences in database:  2,790,947
  
Lambda     K      H
   0.357    0.157    0.562 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 468,928,518
Number of Sequences: 2790947
Number of extensions: 15839491
Number of successful extensions: 69309
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 69308
Number of HSP's gapped (non-prelim): 1
length of query: 346
length of database: 848,049,833
effective HSP length: 128
effective length of query: 218
effective length of database: 490,808,617
effective search space: 106996278506
effective search space used: 106996278506
T: 11
A: 40
X1: 14 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 37 (21.7 bits)
S2: 75 (33.5 bits)