BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC149130.3 - phase: 0 /pseudo
         (171 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Y243_BUCBP (Q89AM4) Hypothetical UPF0274 protein bbp243                33  0.42

>Y243_BUCBP (Q89AM4) Hypothetical UPF0274 protein bbp243
          Length = 217

 Score = 32.7 bits (73), Expect = 0.42
 Identities = 18/68 (26%), Positives = 37/68 (53%), Gaps = 6/68 (8%)

Query: 88  KLFTLVKSCFTSHLRYSNPIGYSSDGSKVLFEGIEVLLDVHYKKLFWYDLKSERVS--YV 145
           K+   + +  T   R  N I Y +    +LF+ + +L+  H  +++ YDL ++R++  Y+
Sbjct: 86  KMIRYIFNLITLENRLENNIKYKN----ILFKELSILIQQHKNRVYTYDLLADRLAQIYL 141

Query: 146 EGIPKLFF 153
           + + KL F
Sbjct: 142 DTVSKLGF 149


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.326    0.143    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,233,461
Number of Sequences: 164201
Number of extensions: 821267
Number of successful extensions: 2479
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2479
Number of HSP's gapped (non-prelim): 1
length of query: 171
length of database: 59,974,054
effective HSP length: 102
effective length of query: 69
effective length of database: 43,225,552
effective search space: 2982563088
effective search space used: 2982563088
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)