BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC148654.4 + phase: 0 
         (246 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

PSD_COXBU (Q83AQ4) Phosphatidylserine decarboxylase proenzyme (E...    33  0.83

>PSD_COXBU (Q83AQ4) Phosphatidylserine decarboxylase proenzyme (EC
           4.1.1.65) [Contains: Phosphatidylserine decarboxylase
           alpha chain; Phosphatidylserine decarboxylase beta
           chain]
          Length = 282

 Score = 32.7 bits (73), Expect = 0.83
 Identities = 23/72 (31%), Positives = 33/72 (44%), Gaps = 7/72 (9%)

Query: 74  IEGRMLSHEKKMLKHKGATLLMRHLGVSQQEAEKICGQEYGGYISYPSLMDFYTTYLGRA 133
           I G + + E  +L      L +RH G++ QEA      +Y     YPS   F+T YL R 
Sbjct: 16  IVGWLATREWGLLTQWAIRLFIRHYGINMQEA------QYPDIGHYPSFNAFFTRYLKR- 68

Query: 134 NLLAGTEDPEEL 145
            L    E+P  +
Sbjct: 69  ELRPVVEEPRAI 80


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.326    0.142    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,710,589
Number of Sequences: 164201
Number of extensions: 1279659
Number of successful extensions: 3014
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3013
Number of HSP's gapped (non-prelim): 1
length of query: 246
length of database: 59,974,054
effective HSP length: 107
effective length of query: 139
effective length of database: 42,404,547
effective search space: 5894232033
effective search space used: 5894232033
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)