BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC146940.4 + phase: 1 /pseudo
         (674 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

KRUB_HUMAN (O75690) Keratin, ultra high-sulfur matrix protein B ...    32  5.4

>KRUB_HUMAN (O75690) Keratin, ultra high-sulfur matrix protein B
           (UHS keratin B) (UHS KerB)
          Length = 194

 Score = 32.0 bits (71), Expect = 5.4
 Identities = 17/42 (40%), Positives = 19/42 (44%), Gaps = 6/42 (14%)

Query: 102 GSCRKV*SCTCKMVHCCIYSLQCSKFTIFSVCGRCSLLHGSR 143
           GS R V  C CK V CC+ +  CS       CG C    G R
Sbjct: 32  GSSRCVPICCCKPVCCCVPACSCSS------CGSCGGSKGGR 67


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.366    0.162    0.645 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 62,787,458
Number of Sequences: 164201
Number of extensions: 2236991
Number of successful extensions: 11521
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11508
Number of HSP's gapped (non-prelim): 14
length of query: 674
length of database: 59,974,054
effective HSP length: 117
effective length of query: 557
effective length of database: 40,762,537
effective search space: 22704733109
effective search space used: 22704733109
T: 11
A: 40
X1: 14 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (21.6 bits)
S2: 69 (31.2 bits)