Medicago
BLAST2 result
BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC146818.2 - phase: 0 /pseudo
         (1427 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

SX13_HUMAN (Q9UN79) SOX-13 protein (Type 1 diabetes autoantigen ...    33  7.3

>SX13_HUMAN (Q9UN79) SOX-13 protein (Type 1 diabetes autoantigen
           ICA12) (Islet cell antigen 12)
          Length = 889

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 16/36 (44%), Positives = 21/36 (57%)

Query: 794 PGM*NFLIWNFLSIPLVLLQFPLHIFTLIVKLLTLC 829
           PG     +W  LS+PL+LL  PL +   + KLL LC
Sbjct: 806 PGTVAEFLWVCLSMPLLLLWGPLSVLLFVPKLLPLC 841


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.370    0.167    0.644 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 128,262,954
Number of Sequences: 164201
Number of extensions: 4320343
Number of successful extensions: 19023
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 19020
Number of HSP's gapped (non-prelim): 3
length of query: 1427
length of database: 59,974,054
effective HSP length: 123
effective length of query: 1304
effective length of database: 39,777,331
effective search space: 51869639624
effective search space used: 51869639624
T: 11
A: 40
X1: 14 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (21.8 bits)
S2: 72 (32.3 bits)


Medicago: description of AC146818.2