BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC139744.1 + phase: 0 
         (48 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

CU02_HUMAN (O43822) Protein C21orf2 (C21orf-HUMF09G8.5) (YF5/A2)       30  0.94

>CU02_HUMAN (O43822) Protein C21orf2 (C21orf-HUMF09G8.5) (YF5/A2)
          Length = 256

 Score = 30.4 bits (67), Expect = 0.94
 Identities = 14/32 (43%), Positives = 21/32 (64%)

Query: 15  NLLSAVLCLVKELDYPSLEVVEMAVKCRMDEL 46
           N+L+A+L L++ELD   LE V+  V  R+  L
Sbjct: 215 NVLTAILLLLRELDAEGLEAVQQTVGSRLQAL 246


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.327    0.137    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,487,878
Number of Sequences: 164201
Number of extensions: 89934
Number of successful extensions: 317
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 316
Number of HSP's gapped (non-prelim): 1
length of query: 48
length of database: 59,974,054
effective HSP length: 24
effective length of query: 24
effective length of database: 56,033,230
effective search space: 1344797520
effective search space used: 1344797520
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)