BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC126015.14 + phase: 0 /pseudo
         (241 letters)

Database: sprot 
           164,201 sequences; 59,974,054 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

NUSB_BORBU (O51134) N utilization substance protein B homolog (N...    30  5.2

>NUSB_BORBU (O51134) N utilization substance protein B homolog (NusB
           protein)
          Length = 145

 Score = 30.0 bits (66), Expect = 5.2
 Identities = 15/43 (34%), Positives = 24/43 (54%)

Query: 181 VLEDIRRNWHKLSVLTVTMLILLIGIYSIGCCAFRNARRAETD 223
           ++ DI  NW    +  V + IL +G+YS+    F N++RA  D
Sbjct: 67  LIRDISLNWSLERMDKVDLAILRMGVYSLKFQNFENSKRAIID 109


  Database: sprot
    Posted date:  Nov 25, 2004 10:54 AM
  Number of letters in database: 59,974,054
  Number of sequences in database:  164,201
  
Lambda     K      H
   0.343    0.149    0.575 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,445,530
Number of Sequences: 164201
Number of extensions: 1006964
Number of successful extensions: 4143
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4142
Number of HSP's gapped (non-prelim): 1
length of query: 241
length of database: 59,974,054
effective HSP length: 107
effective length of query: 134
effective length of database: 42,404,547
effective search space: 5682209298
effective search space used: 5682209298
T: 11
A: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.6 bits)
S2: 64 (29.3 bits)