BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC144515.17 - phase: 0 /pseudo
         (58 letters)

Database: nr 
           2,540,612 sequences; 863,360,394 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_706653.1| biotin synthesis, sulfur insertion? [Shigella f...    31  7.6

>ref|NP_706653.1| biotin synthesis, sulfur insertion? [Shigella flexneri 2a str.
          301] gi|24050978|gb|AAN42360.1| biotin synthesis,
          sulfur insertion? [Shigella flexneri 2a str. 301]
          gi|30062260|ref|NP_836431.1| biotin synthesis, sulfur
          insertion? [Shigella flexneri 2a str. 2457T]
          gi|30040505|gb|AAP16237.1| biotin synthesis, sulfur
          insertion? [Shigella flexneri 2a str. 2457T]
          Length = 346

 Score = 31.2 bits (69), Expect = 7.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 3  MNEVHMLNVRPILSNLGEVDLVHRNHTRPRRYQLLQIMCVLDPSC 47
          +++V  L  +P+L  L E   VHR H  PR+ Q+  ++ +   +C
Sbjct: 9  LSQVTELFEKPLLDLLFEAQQVHRQHFEPRQVQVSTLLSIKTGAC 53


  Database: nr
    Posted date:  Jul 5, 2005 12:34 AM
  Number of letters in database: 863,360,394
  Number of sequences in database:  2,540,612
  
Lambda     K      H
   0.334    0.142    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 93,881,338
Number of Sequences: 2540612
Number of extensions: 2664279
Number of successful extensions: 7703
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 7702
Number of HSP's gapped (non-prelim): 1
length of query: 58
length of database: 863,360,394
effective HSP length: 34
effective length of query: 24
effective length of database: 776,979,586
effective search space: 18647510064
effective search space used: 18647510064
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 68 (30.8 bits)