BLASTP 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC139854.1 - phase: 0 /pseudo
         (406 letters)

Database: nr 
           2,540,612 sequences; 863,360,394 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK81010.1| Glycosyltransferase [Clostridium acetobutylicum A...    34  7.1

>gb|AAK81010.1| Glycosyltransferase [Clostridium acetobutylicum ATCC 824]
           gi|15896321|ref|NP_349670.1| Glycosyltransferase
           [Clostridium acetobutylicum ATCC 824]
           gi|25500792|pir||G97277 glycosyltransferase [imported] -
           Clostridium acetobutylicum
          Length = 370

 Score = 34.3 bits (77), Expect = 7.1
 Identities = 16/46 (34%), Positives = 23/46 (49%)

Query: 305 RELHLVARYSEQITRHSELTSEENLILRINSFSRALDIFGCLNMYK 350
           + LH +ARY+ +I +H        +IL +N    A  IFG  N  K
Sbjct: 16  KHLHGIARYTYEIIKHMSYEDNVEMILLVNDLEEASKIFGQFNNIK 61


  Database: nr
    Posted date:  Jul 5, 2005 12:34 AM
  Number of letters in database: 863,360,394
  Number of sequences in database:  2,540,612
  
Lambda     K      H
   0.369    0.170    0.610 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 523,561,999
Number of Sequences: 2540612
Number of extensions: 17596259
Number of successful extensions: 93573
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 93572
Number of HSP's gapped (non-prelim): 1
length of query: 406
length of database: 863,360,394
effective HSP length: 130
effective length of query: 276
effective length of database: 533,080,834
effective search space: 147130310184
effective search space used: 147130310184
T: 11
A: 40
X1: 14 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 36 (21.7 bits)
S2: 76 (33.9 bits)