TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC146719.6 - phase: 0 /pseudo
         (312 letters)

Database: MTGI 
           36,976 sequences; 27,044,181 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

BG644693 weakly similar to GP|18767374|g Putative 22 kDa kafirin...    32  0.24

>BG644693 weakly similar to GP|18767374|g Putative 22 kDa kafirin cluster;
           Ty3-Gypsy type {Oryza sativa}, partial (15%)
          Length = 716

 Score = 32.3 bits (72), Expect = 0.24
 Identities = 28/77 (36%), Positives = 39/77 (50%)
 Frame = +3

Query: 199 TRLK*KMKICRRQLLERGMHIMSIKLCLSVLQMHLVCLWST*IAFFMHFWTVSWLFLLMT 258
           T + * +K+  + L E  M  M    CL   Q+    LW+ *I F     T   LFL+M 
Sbjct: 360 TNIG**VKMFLKLLSELDMVTMKS**CLLGKQIPRWHLWN**IEFSKITSTH**LFLVMI 539

Query: 259 F*FTPRLRKNMLSI*RW 275
           F*+TPR++ +M   * W
Sbjct: 540 F*YTPRMKMSMRIT*GW 590


  Database: MTGI
    Posted date:  Oct 22, 2004  3:39 PM
  Number of letters in database: 27,044,181
  Number of sequences in database:  36,976
  
Lambda     K      H
   0.378    0.167    0.656 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,316,727
Number of Sequences: 36976
Number of extensions: 188198
Number of successful extensions: 3979
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2198
Number of HSP's successfully gapped in prelim test: 149
Number of HSP's that attempted gapping in prelim test: 1645
Number of HSP's gapped (non-prelim): 2520
length of query: 312
length of database: 9,014,727
effective HSP length: 96
effective length of query: 216
effective length of database: 5,465,031
effective search space: 1180446696
effective search space used: 1180446696
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 13 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 35 (21.7 bits)
S2: 58 (26.9 bits)