TBLASTN 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AC146552.5 - phase: 0 /pseudo
         (43 letters)

Database: MTGI 
           36,976 sequences; 27,044,181 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

TC89445 similar to GP|7417006|gb|AAF62403.1| harpin inducing pro...    25  5.0

>TC89445 similar to GP|7417006|gb|AAF62403.1| harpin inducing protein
           {Nicotiana tabacum}, partial (36%)
          Length = 651

 Score = 25.4 bits (54), Expect = 5.0
 Identities = 18/35 (51%), Positives = 19/35 (53%), Gaps = 1/35 (2%)
 Frame = +2

Query: 10  HRRDHKGD-ATMPAAASAVASWAALEAVADACSTA 43
           HR  +  D AT   AASA  S AA   VA A STA
Sbjct: 113 HRNQNLVDTATTTVAASAAVSAAAFVVVAAAFSTA 217


  Database: MTGI
    Posted date:  Oct 22, 2004  3:39 PM
  Number of letters in database: 27,044,181
  Number of sequences in database:  36,976
  
Lambda     K      H
   0.315    0.116    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,178,185
Number of Sequences: 36976
Number of extensions: 7922
Number of successful extensions: 38
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of query: 43
length of database: 9,014,727
effective HSP length: 19
effective length of query: 24
effective length of database: 8,312,183
effective search space: 199492392
effective search space used: 199492392
frameshift window, decay const: 50,  0.1
T: 13
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)